PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G014300.1
Common NamePHAVU_005G014300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YC
Protein Properties Length: 288aa    MW: 31813.3 Da    PI: 5.1654
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G014300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.41.8e-196861898
               NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                        ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl div r
  Phvul.005G014300.1  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNALHLKHCVQSYNVFDFLRDIVSR 86
                        5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-26372IPR009072Histone-fold
SuperFamilySSF471131.02E-20494IPR009072Histone-fold
PfamPF008081.4E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK  60
TMNALHLKHC VQSYNVFDFL RDIVSRVPDY GHGHGHFEGG ADDRALSKRS RKAAGVEGNE  120
SDEESKRSKM RELGHTGTPG RGRGRGRGRG RGRGIRPVET DIGHQQVESE PCSSIQQISN  180
DIPNTSLPID NGVQSKECSK ENFAAHEEST QSFRNIDLNA NLNENEDKNA SAAVQASVPE  240
PADMDIKHEE IPGWSLSEVD KMAIDTMQLA TLGSRLEEDD EDYDEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A5e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142152RGRGRGRGRGR
2144153RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148787.10.0hypothetical protein PHAVU_005G014300g
TrEMBLV7BW340.0V7BW34_PHAVU; Uncharacterized protein
STRINGGLYMA06G46850.11e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-74nuclear factor Y, subunit C11